PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf15390g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 231aa    MW: 23934.4 Da    PI: 5.7932
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf15390g00003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.24.3e-392583361
                    zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                               ++l+cprCdstntkfCyynny+lsqPr+fCk+CrryWt+GG+lrn+PvGgg+rkn ++
  Niben101Scf15390g00003.1 25 PENLPCPRCDSTNTKFCYYNNYNLSQPRHFCKSCRRYWTRGGTLRNIPVGGGTRKNSSH 83
                              57899**************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-252482IPR003851Zinc finger, Dof-type
PfamPF027013.0E-332782IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4882882IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103066IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MSSEVGDRRP ARLPAPANGT RPSEPENLPC PRCDSTNTKF CYYNNYNLSQ PRHFCKSCRR  60
YWTRGGTLRN IPVGGGTRKN SSHKRPRNTT SVTAQESVNA TPITMIGSSQ SSGSGSVSFM  120
GCEVNLNESV QEAGGAANGT FTSLLTGPMG GGFVPLGGFG LGLGGFGLGT LDWPMEQVGG  180
GNGGGGDDGE NMKWQLSSGD IEGGGGGGID DDDCFGNWPD LAISAPGTSL K
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009592897.11e-123PREDICTED: dof zinc finger protein DOF3.4-like
RefseqXP_016447560.11e-123PREDICTED: dof zinc finger protein DOF3.4-like
TrEMBLK4BV418e-85K4BV41_SOLLC; Uncharacterized protein
STRINGSolyc04g079570.1.12e-84(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66940.17e-34Dof family protein